PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo11G0025700
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family MYB
Protein Properties Length: 220aa    MW: 24613.7 Da    PI: 7.0475
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo11G0025700genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.94.8e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W+ eEde+lv +++++G g+W++ ++  g+ R++k+c++rw++yl
  Spipo11G0025700 14 KGPWSLEEDEILVSYIQRYGHGNWRALPKQAGLSRCGKSCRLRWLNYL 61
                     79********************************************97 PP

2Myb_DNA-binding53.94.1e-1767112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T+eE+e ++ ++ qlG++ W++Ia++++ gRt++++k+ w+++l
  Spipo11G0025700  67 RGNFTKEEEEAIIALHGQLGNR-WSAIAARLP-GRTDNEIKNVWHTHL 112
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.162961IPR017930Myb domain
SuperFamilySSF466891.68E-3111108IPR009057Homeodomain-like
SMARTSM007171.4E-141363IPR001005SANT/Myb domain
PfamPF002491.9E-161461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.6E-251568IPR009057Homeodomain-like
CDDcd001672.69E-111661No hitNo description
PROSITE profilePS5129425.7962116IPR017930Myb domain
SMARTSM007174.9E-1566114IPR001005SANT/Myb domain
PfamPF002496.5E-1567112IPR001005SANT/Myb domain
CDDcd001671.97E-1169112No hitNo description
Gene3DG3DSA:1.10.10.609.1E-2769116IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 220 aa     Download sequence    Send to blast
MVRAVRCREA GLKKGPWSLE EDEILVSYIQ RYGHGNWRAL PKQAGLSRCG KSCRLRWLNY  60
LRPDIKRGNF TKEEEEAIIA LHGQLGNRWS AIAARLPGRT DNEIKNVWHT HLKKRMTPSP  120
ASSEPKKSPG DATAVSGTPE SSPGSSNEVS STVRMMSSET KDTRVNVENS SPLDEFLEGI  180
ENSWDPPPVF IDHSPVDDGM DFWRRVLMEG GEQPDLIIF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-271211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010934323.11e-76PREDICTED: myb-related protein Myb4-like
SwissprotQ7XBH41e-69MYB4_ORYSJ; Myb-related protein Myb4
TrEMBLM0RYC75e-74M0RYC7_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr1P09180_0011e-73(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP7938563
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G23250.11e-66myb domain protein 15